Loading...
Statistics

About Lori Sheffield - Hill Country Therapy & Testing
www.wiseslp.com/
Lori Sheffield is a licensed marriage and family associate in Lakeway, Texas who provides individual, couples, child, and family therapy.

Wiseslp.com

Domain is redirected to: Hillcountrypsychology.com
Wiseslp.com is hosted in United States / San Francisco . Wiseslp.com doesn't use HTTPS protocol. Number of used technologies: 5. First technologies: CSS, Html, Html5, Number of used javascripts: 4. First javascripts: Jquery.min.js, Stl.js, Main.js, Number of used analytics tools: 2. First analytics tools: Google Analytics, Quantcast Measurement, Its server type is: nginx. Its CMS is: Webly.

Technologies in use by Wiseslp.com

Technology

Number of occurences: 5
  • CSS
  • Html
  • Html5
  • Javascript
  • Php

Javascripts

Number of occurences: 4
  • jquery.min.js
  • stl.js
  • main.js

Content Management System

Number of occurences: 1
  • Webly

Analytics

Number of occurences: 2
  • Google Analytics
  • Quantcast Measurement

Server Type

  • nginx

Conversion rate optimization

visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Wiseslp.com

Missing HTTPS protocol.

    Meta - Wiseslp.com

    Number of occurences: 3
    • Name:
      Content: text/html; charset=utf-8
    • Name: description
      Content: Lori Sheffield is a licensed marriage and family associate in Lakeway, Texas who provides individual, couples, child, and family therapy.
    • Name: keywords
      Content: counseling, therapist, Lakeway, therapy, family, child, adult, couple, marital, pediatric

    Server / Hosting

    • IP: 199.34.228.58
    • Latitude: 37.77
    • Longitude: -122.39
    • Country: United States
    • City: San Francisco

    Rname

    • dns2.registrar-servers.com
    • dns3.registrar-servers.com
    • dns4.registrar-servers.com
    • dns5.registrar-servers.com
    • dns1.registrar-servers.com
    • eforward3.registrar-servers.com
    • eforward4.registrar-servers.com
    • eforward5.registrar-servers.com
    • eforward1.registrar-servers.com
    • eforward2.registrar-servers.com

    Target

    • hostmaster.registrar-servers.com,

    HTTP Header Response

    HTTP/1.1 302 Found Server: nginx Date: Mon, 19 Sep 2016 08:35:04 GMT Content-Type: text/html Content-Length: 154 Location: http://www.hillcountrypsychology.com/stephanie-wise.html X-Cache: MISS from s_ub15 Via: 1.1 s_ub15 (squid/3.5.20) Connection: keep-alive HTTP/1.1 200 OK Date: Mon, 19 Sep 2016 08:35:04 GMT Server: Apache Set-Cookie: is_mobile=0; path=/; domain=www.hillcountrypsychology.com Set-Cookie: language=en; expires=Mon, 03-Oct-2016 08:35:04 GMT; Max-Age=1209600; path=/ Cache-Control: private ETag: W/"992ef342a8ca2e0754803f57ff8d9cef" Vary: Accept-Encoding,User-Agent X-Host: pages9.sf2p.intern.weebly.net X-UA-Compatible: IE=edge,chrome=1 Content-Type: text/html; charset=UTF-8 X-W-DC: SFO X-Cache: MISS from s_ub15 Transfer-Encoding: chunked Via: 1.1 s_ub15 (squid/3.5.20) Connection: keep-alive

    DNS

    host: wiseslp.com
    1. class: IN
    2. ttl: 1799
    3. type: A
    4. ip: 192.64.119.242
    host: wiseslp.com
    1. class: IN
    2. ttl: 1800
    3. type: NS
    4. target: dns2.registrar-servers.com
    host: wiseslp.com
    1. class: IN
    2. ttl: 1800
    3. type: NS
    4. target: dns3.registrar-servers.com
    host: wiseslp.com
    1. class: IN
    2. ttl: 1800
    3. type: NS
    4. target: dns4.registrar-servers.com
    host: wiseslp.com
    1. class: IN
    2. ttl: 1800
    3. type: NS
    4. target: dns5.registrar-servers.com
    host: wiseslp.com
    1. class: IN
    2. ttl: 1800
    3. type: NS
    4. target: dns1.registrar-servers.com
    host: wiseslp.com
    1. class: IN
    2. ttl: 3601
    3. type: SOA
    4. mname: dns1.registrar-servers.com,
    5. rname: hostmaster.registrar-servers.com,
    6. serial: 2015122311
    7. refresh: 43200
    8. retry: 3600
    9. expire: 604800
    10. minimum-ttl: 3601
    host: wiseslp.com
    1. class: IN
    2. ttl: 1800
    3. type: MX
    4. pri: 10
    5. target: eforward3.registrar-servers.com
    host: wiseslp.com
    1. class: IN
    2. ttl: 1800
    3. type: MX
    4. pri: 15
    5. target: eforward4.registrar-servers.com
    host: wiseslp.com
    1. class: IN
    2. ttl: 1800
    3. type: MX
    4. pri: 20
    5. target: eforward5.registrar-servers.com
    host: wiseslp.com
    1. class: IN
    2. ttl: 1800
    3. type: MX
    4. pri: 10
    5. target: eforward1.registrar-servers.com
    host: wiseslp.com
    1. class: IN
    2. ttl: 1800
    3. type: MX
    4. pri: 10
    5. target: eforward2.registrar-servers.com
    host: wiseslp.com
    1. class: IN
    2. ttl: 1800
    3. type: TXT
    4. txt: v=spf1 include:spf.efwd.registrar-servers.com ~all
    5. entries: Array

    Common Typos/Mistakes

    This list shows You some spelling mistakes at internet search for this domain.

    www.iseslp.com, www.w iseslp.com, www. iseslp.com, www.wciseslp.com, www.ciseslp.com, www.wiseslp.com, www.iseslp.com, www.wdiseslp.com, www.diseslp.com, www.wfiseslp.com, www.fiseslp.com, www.wgiseslp.com, www.giseslp.com, www.wbiseslp.com, www.biseslp.com, www.wseslp.com, www.wirseslp.com, www.wrseslp.com, www.wifseslp.com, www.wfseslp.com, www.wivseslp.com, www.wvseslp.com, www.wikseslp.com, www.wkseslp.com, www.wi,seslp.com, www.w,seslp.com, www.wibseslp.com, www.wbseslp.com, www.wigseslp.com, www.wgseslp.com, www.witseslp.com, www.wtseslp.com, www.wiyseslp.com, www.wyseslp.com, www.wiuseslp.com, www.wuseslp.com, www.wijseslp.com, www.wjseslp.com, www.wimseslp.com, www.wmseslp.com, www.winseslp.com, www.wnseslp.com, www.wieslp.com, www.wiseeslp.com, www.wieeslp.com, www.wisweslp.com, www.wiweslp.com, www.wisdeslp.com, www.wideslp.com, www.wisxeslp.com, www.wixeslp.com, www.wisfeslp.com, www.wifeslp.com, www.wisgeslp.com, www.wigeslp.com, www.wisteslp.com, www.witeslp.com, www.wisslp.com, www.wisxslp.com, www.wisesslp.com, www.wissslp.com, www.wisewslp.com, www.wiswslp.com, www.wiserslp.com, www.wisrslp.com, www.wisefslp.com, www.wisfslp.com, www.wisevslp.com, www.wisvslp.com, www.wisecslp.com, www.wiscslp.com, www.wiseqslp.com, www.wisqslp.com, www.wiseaslp.com, www.wisaslp.com, www.wiseyslp.com, www.wisyslp.com, www.wiselp.com, www.wiseselp.com, www.wiseelp.com, www.wiseswlp.com, www.wisewlp.com, www.wisesdlp.com, www.wisedlp.com, www.wisesxlp.com, www.wisesflp.com, www.wiseflp.com, www.wisesglp.com, www.wiseglp.com, www.wisestlp.com, www.wisetlp.com, www.wisesp.com, www.wiseslup.com, www.wisesup.com, www.wisesl8p.com, www.wises8p.com, www.wisesl9p.com, www.wises9p.com, www.wisesljp.com, www.wisesjp.com, www.wisesl0p.com, www.wises0p.com, www.wiseslmp.com, www.wisesmp.com, www.wiseslpp.com, www.wisespp.com, www.wiseslop.com, www.wisesop.com, www.wisesl.com, www.wiseslpi.com, www.wisesli.com, www.wiseslpk.com, www.wiseslk.com, www.wiseslpu.com, www.wiseslu.com, www.wiseslpj.com, www.wiseslj.com, www.wiseslpl.com, www.wisesll.com,

    Other websites we recently analyzed

    1. cfvrf.ru
      Russian Federation - 194.85.61.76
      Server software: nginx
      Technology: CSS, Html, Html5, Javascript
      Number of meta tags: 5
    2. lokoz.com - the best seo hosting
      We specialize in services for SEO market. We provide SEO hosting since 2007.
      France - 94.23.180.62
      Server software: Apache/2
      Technology: AJAX Libraries API, CSS, Google Font API, Html, Html5
      Number of Javascript: 2
      Number of meta tags: 4
    3. fcftv.com
      Seattle (United States) - 50.22.171.195
      Server software: Apache
      Technology: Html
      Number of meta tags: 1
    4. Hamburg Pest Control - Exterminators, Pest Control, Pest Removal & Pest Management Services in Hamburg NY, Orchard Park NY and WNY
      San Francisco (United States) - 199.34.228.55
      Server software: Apache
      Technology: CSS, Html, Html5, Javascript, Php, Google Analytics, Quantcast Measurement, Webly
      Number of Javascript: 7
      Number of meta tags: 2
    5. pcg-b2p.space
      China - 103.232.215.140
      Server software: Tengine/1.4.2
      Technology: CloudFront, Google Adsense, Html, Javascript, Php
      Number of Javascript: 2
      Number of meta tags: 1
    6. Dokument nicht Gefunden!
      Germany - 213.135.0.4
      Server software: Apache
      Technology: Html
    7. RedT Homes - 19th Row II
      Scottsdale (United States) - 50.62.99.1
      G Analytics ID: UA-50126259-24
      Server software: Microsoft-IIS/7.5
      Technology: CSS, Flexslider, Font Awesome, Google Font API, Html, Html5, Iframe, Javascript, jQuery, Php, Pingback, Revslider, Shortcodes, Google Analytics, Wordpress
      Number of Javascript: 24
      Number of meta tags: 2
    8. et-s.cn
      Kowloon (Hong Kong) - 123.1.149.57
      Server software: squid/3.5.12
      Technology: Html, Html5, Javascript
      Number of meta tags: 1
    9. vippscanadianpharmacyreviews.ru
      vippscanadianpharmacyreviews.ru
      Saint Louis (United States) - 69.64.32.180
      Server software: nginx/1.1.19
      Technology: Html
      Number of meta tags: 2
    10. Bob the BA - Business Analysis Training
      Business Analysis Training for Business Analysts Project Managers and Project Professionals
      New York (United States) - 198.185.159.145
      Server software: Protected by COMODO WAF mod_bwlimited/1.4
      Technology: CSS, Html, Javascript, Lightbox, Php, SVG, Google Analytics, Squarespace
      Number of Javascript: 2
      Number of meta tags: 9

    Check Other Websites